PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10163_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 345aa    MW: 37927.9 Da    PI: 9.4725
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10163_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-3972131362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s+
  RrC10163_p2  72 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSK 131
                  6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3755129IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3274129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46975129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFSSLPVNQ FDSHNWQQQG NTQQLDRATS DQNPSYNLPQ FSSPPASQAG SSQARLNSMV  60
ERARIAKIPL PEAALKCPRC DSTNTKFCYF NNYNLTQPRH FCKTCRRYWT RGGALRNVPV  120
GGGFRRNKRS KPNGGRSKAT VVVSADNNNT TSLLSCQPSY SNSNKFLSYG QMPGFNSNLP  180
ILPPFQSLGD YNSSGIGLDW SSSGGILDPW RISLLQQPQQ FPFLINTKGL EQSSNVMYPS  240
LEGNGGVNHA KLQQESNDYS NQLRSKPLMD MASSGDQAVQ ARYVKAEEND QGGNGVSNLS  300
RNFLGNMNIK PVEENDGYTS WGGSSNISSS WTGFTSNNST GHLSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124131RRNKRSKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116230.10.0PREDICTED: dof zinc finger protein DOF3.6
RefseqXP_013708601.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
RefseqXP_013708600.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
SwissprotQ9M2U11e-151DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLM4CSG40.0M4CSG4_BRARP; Uncharacterized protein
STRINGBra007156.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.21e-143OBF-binding protein 3